(data stored in ACNUC7421 zone)

EMBL: CP001720.PE230

CP001720.PE230       Location/Qualifiers
FT   CDS             261742..262125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0242"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: bsu:BSU22410 aspartate alpha-decarboxylase;
FT                   TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61195"
FT                   /db_xref="GOA:C8W3U1"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U1"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ACV61195.1"
FT                   /translation="MFLTMFKSKIHRATVTEANLNYMGSITVDRSLLEAANILPHEKVQ
FT                   IVNNNNGNRFETYTIAGPRDSGVVCLNGAAARMVQQGDTVIIIAYTMLDAEEAKTFQPR
FT                   IVFLDEKNRVERVANGENHGDIG"
     MFLTMFKSKI HRATVTEANL NYMGSITVDR SLLEAANILP HEKVQIVNNN NGNRFETYTI        60
     AGPRDSGVVC LNGAAARMVQ QGDTVIIIAY TMLDAEEAKT FQPRIVFLDE KNRVERVANG       120
     ENHGDIG                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page