(data stored in ACNUC7421 zone)

EMBL: CP001720.PE232

CP001720.PE232       Location/Qualifiers
FT   CDS             complement(262980..263969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0244"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: baa:BA_2078 biotin/lipoate A/B protein ligase
FT                   family; TIGRFAM: biotin/acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin/lipoate A/B protein ligase; Helix-turn- helix
FT                   type 11 domain protein; biotin protein ligase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61197"
FT                   /db_xref="GOA:C8W3U3"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U3"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ACV61197.1"
FT                   /translation="MKNRILELLKFDRESYISGEEICRILGVSRTAVWKHIQVLRDEGY
FT                   KILSMPSKGYCLTAIPDRLYPEEIMSGLLTKSLGRDVRYFEIVDSTNNKAKELAGFKGL
FT                   SHEAGLTAAEGMLVIAEEQTGGRGRLGRSWHAPYGKGIWMSVLLRPQVCLEIVYQMTMI
FT                   TAVAVMRAVREVCGIAPEIKWPNDLQYEGKKLCGILTEMSAEADRVNYIVVGIGINTAS
FT                   AGDLIPPQITHQMTSLSEITGKPVSRVKLVQEVLQELEACYDSWLAGGFPELLEEWKSH
FT                   CNSLNRQVAVKTLHEVYTGWSMDVNSDGALLLKLDNGEIKKFVSGDVS"
     MKNRILELLK FDRESYISGE EICRILGVSR TAVWKHIQVL RDEGYKILSM PSKGYCLTAI        60
     PDRLYPEEIM SGLLTKSLGR DVRYFEIVDS TNNKAKELAG FKGLSHEAGL TAAEGMLVIA       120
     EEQTGGRGRL GRSWHAPYGK GIWMSVLLRP QVCLEIVYQM TMITAVAVMR AVREVCGIAP       180
     EIKWPNDLQY EGKKLCGILT EMSAEADRVN YIVVGIGINT ASAGDLIPPQ ITHQMTSLSE       240
     ITGKPVSRVK LVQEVLQELE ACYDSWLAGG FPELLEEWKS HCNSLNRQVA VKTLHEVYTG       300
     WSMDVNSDGA LLLKLDNGEI KKFVSGDVS                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page