(data stored in ACNUC7421 zone)

EMBL: CP001720.PE234

CP001720.PE234       Location/Qualifiers
FT   CDS             264828..265592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0246"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: gme:Gmet_1986
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61199"
FT                   /db_xref="GOA:C8W3U5"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3U5"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ACV61199.1"
FT                   /translation="MLLVFDVGNTNIVLGLYSKKKLLENWRISTDRGCTADEYGILVRS
FT                   LFASCSIPTGEVRAMVISSVVPPLMSTLEEMSKKYFKVAPLFVGPGVKTGIAIKYDNPK
FT                   EVGADRIVNAVAGYELYRGPLVIVDFGTATTFCAVSEKGEYLGGAIAPGIGISAEALFS
FT                   RAAKLSRVDIVKPELAIAKNTVNSMQAGIFYGFVGQVKELVRRIKQEMSGNPYVVATGG
FT                   FAALIAQETDNIDKVDPFLTLTGLRIIYERNC"
     MLLVFDVGNT NIVLGLYSKK KLLENWRIST DRGCTADEYG ILVRSLFASC SIPTGEVRAM        60
     VISSVVPPLM STLEEMSKKY FKVAPLFVGP GVKTGIAIKY DNPKEVGADR IVNAVAGYEL       120
     YRGPLVIVDF GTATTFCAVS EKGEYLGGAI APGIGISAEA LFSRAAKLSR VDIVKPELAI       180
     AKNTVNSMQA GIFYGFVGQV KELVRRIKQE MSGNPYVVAT GGFAALIAQE TDNIDKVDPF       240
     LTLTGLRIIY ERNC                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page