(data stored in ACNUC7421 zone)

EMBL: CP001720.PE239

CP001720.PE239       Location/Qualifiers
FT   CDS             269023..270522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0251"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: bha:BH0098 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61204"
FT                   /db_xref="GOA:C8W3V0"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V0"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ACV61204.1"
FT                   /translation="MSIEEELSSAENLNELSELMRVRREKLQELIDKGYHPYGDKYDRL
FT                   HCSAEIINNFEQYEGQEVSVAGRLMAKRGHGKAGFANLQDTAGSIQVYGRLNNLGSEDY
FT                   ELFQKLDIGDIIGVKGKVFRTQKGEITVEIQVLTLLSKSLRPLPEKWHGLRDVELRYRQ
FT                   RYVDLIVNPEVKNQFVARSQIVRCIRNLLDEKGFLEVETPMMQSIAGGAAARPFITHHN
FT                   ALDMELYLRIAPELYLKRLLVGGFDKVYEINRNFRNEGISTKHNPEFTMLELYQAYADY
FT                   YDMMEMAEYLVYNTSLRVNGTPVISYQEQEINLVPPWNRMPMLEAVKKYSGLDFSMLKS
FT                   DQEAVKAAQGLGLGVVQPSDTWGEVLNKVFEEMVEPKLIQPTFIIDYPVEISPLAKKKD
FT                   DDASLTYRFELFIYGREMANAFSELNDPIDQKARFQKQVEQRRSGDDEAHMMDEDYIQA
FT                   LEYGMPPAGGLGIGIDRLVMLLTNAASIRDIILFPLLKPRE"
     MSIEEELSSA ENLNELSELM RVRREKLQEL IDKGYHPYGD KYDRLHCSAE IINNFEQYEG        60
     QEVSVAGRLM AKRGHGKAGF ANLQDTAGSI QVYGRLNNLG SEDYELFQKL DIGDIIGVKG       120
     KVFRTQKGEI TVEIQVLTLL SKSLRPLPEK WHGLRDVELR YRQRYVDLIV NPEVKNQFVA       180
     RSQIVRCIRN LLDEKGFLEV ETPMMQSIAG GAAARPFITH HNALDMELYL RIAPELYLKR       240
     LLVGGFDKVY EINRNFRNEG ISTKHNPEFT MLELYQAYAD YYDMMEMAEY LVYNTSLRVN       300
     GTPVISYQEQ EINLVPPWNR MPMLEAVKKY SGLDFSMLKS DQEAVKAAQG LGLGVVQPSD       360
     TWGEVLNKVF EEMVEPKLIQ PTFIIDYPVE ISPLAKKKDD DASLTYRFEL FIYGREMANA       420
     FSELNDPIDQ KARFQKQVEQ RRSGDDEAHM MDEDYIQALE YGMPPAGGLG IGIDRLVMLL       480
     TNAASIRDII LFPLLKPRE                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page