(data stored in ACNUC7421 zone)

EMBL: CP001720.PE245

CP001720.PE245       Location/Qualifiers
FT   CDS             282983..284062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0257"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; helix-
FT                   hairpin-helix motif; KEGG: bsu:BSU00880 DNA integrity
FT                   scanning protein DisA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61210"
FT                   /db_xref="GOA:C8W3V6"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V6"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ACV61210.1"
FT                   /translation="MKEEKAEDQLLKVLRFVAPGTSLREGLENILRAKTGGLVVVGDYP
FT                   EVLDIAEGGFAINADYSSANLYELAKMDGAIVLSEDAKRILAANVQLIPSQNIPSSETG
FT                   IRHRTSERVARQTNALVIAISQRRSVISVYKGNLKYVLRDLGVILTKANQAVQTLEKYR
FT                   AVSDKVLVNLSILEYDGVVTLFDVAKVIQRVEMVLRIVKEIEKYISELGTEGRLITMQL
FT                   EELLANVAEEGFLVIQDYGTVLEEKPPQSIMKIIGSWPAEDLLDLSLIARALGYPGSSG
FT                   ILDQSVFPRGYRILEKLPRLPFPVIENLVQRFGTLSKVLVATIEELDEVEGIGEVRARS
FT                   IKKGLSRYREQLLTQERHT"
     MKEEKAEDQL LKVLRFVAPG TSLREGLENI LRAKTGGLVV VGDYPEVLDI AEGGFAINAD        60
     YSSANLYELA KMDGAIVLSE DAKRILAANV QLIPSQNIPS SETGIRHRTS ERVARQTNAL       120
     VIAISQRRSV ISVYKGNLKY VLRDLGVILT KANQAVQTLE KYRAVSDKVL VNLSILEYDG       180
     VVTLFDVAKV IQRVEMVLRI VKEIEKYISE LGTEGRLITM QLEELLANVA EEGFLVIQDY       240
     GTVLEEKPPQ SIMKIIGSWP AEDLLDLSLI ARALGYPGSS GILDQSVFPR GYRILEKLPR       300
     LPFPVIENLV QRFGTLSKVL VATIEELDEV EGIGEVRARS IKKGLSRYRE QLLTQERHT        359
//

If you have problems or comments...

PBIL Back to PBIL home page