(data stored in ACNUC7421 zone)

EMBL: CP001720.PE246

CP001720.PE246       Location/Qualifiers
FT   CDS             complement(284097..284495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61211"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61211.1"
FT                   /translation="MLKDLICDEFQNTVSESLVYHRSILDLLSKLQQANANISRDVIKA
FT                   VTNCGCLQINAQKQAIPKDTPLGDLKRYFQTHLSGKACEHCQESIENQIGQHLFYIAAI
FT                   CNLLDINLYDVFIKKQKQMEILGMFNLS"
     MLKDLICDEF QNTVSESLVY HRSILDLLSK LQQANANISR DVIKAVTNCG CLQINAQKQA        60
     IPKDTPLGDL KRYFQTHLSG KACEHCQESI ENQIGQHLFY IAAICNLLDI NLYDVFIKKQ       120
     KQMEILGMFN LS                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page