(data stored in ACNUC7421 zone)

EMBL: CP001720.PE248

CP001720.PE248       Location/Qualifiers
FT   CDS             285368..286519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0260"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SMART: Nucleotide
FT                   binding protein PINc; KEGG: baa:BA_0673 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61213"
FT                   /db_xref="GOA:C8W3V9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3V9"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACV61213.1"
FT                   /translation="MVKRVVFFLLVALFAAGGFFSGYYVVESGIIDFSGSSLNLRVGVF
FT                   ALATLIGVVVGILAAPWIIKSTVWATAKIERYFQKTPTQDLVMGSIGLITGLIIASLFF
FT                   NILPNWGWVSVIKVLGAILLGYLGMSLGVKKREEIFGLFATIPKFGKEKLSKSDSKANV
FT                   DKILDTSVIIDGRIADLCASGFIEGTLMIPVFVLEELRHIADSPDLLKRNRGRRGLDIL
FT                   NNLRKNSDIKVQIYENTRGLENVPEVDMKLVKLAQKLGIKVMTNDYNLNKVAELHGVKV
FT                   LNINELANAVKPIVLPGEEMVVQVVKDGKESGQGVAYLDDGTMIVVDGGRKYIGQTIVV
FT                   VVTSVLQTAAGRMIFAKSKNELKKGENGGGQLSYNEVNYFESN"
     MVKRVVFFLL VALFAAGGFF SGYYVVESGI IDFSGSSLNL RVGVFALATL IGVVVGILAA        60
     PWIIKSTVWA TAKIERYFQK TPTQDLVMGS IGLITGLIIA SLFFNILPNW GWVSVIKVLG       120
     AILLGYLGMS LGVKKREEIF GLFATIPKFG KEKLSKSDSK ANVDKILDTS VIIDGRIADL       180
     CASGFIEGTL MIPVFVLEEL RHIADSPDLL KRNRGRRGLD ILNNLRKNSD IKVQIYENTR       240
     GLENVPEVDM KLVKLAQKLG IKVMTNDYNL NKVAELHGVK VLNINELANA VKPIVLPGEE       300
     MVVQVVKDGK ESGQGVAYLD DGTMIVVDGG RKYIGQTIVV VVTSVLQTAA GRMIFAKSKN       360
     ELKKGENGGG QLSYNEVNYF ESN                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page