(data stored in ACNUC7421 zone)

EMBL: CP001720.PE25

CP001720.PE25        Location/Qualifiers
FT   CDS             27663..29606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0026"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: sit:TM1040_1226 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60990"
FT                   /db_xref="GOA:C8VVC5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027980"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR040506"
FT                   /db_xref="InterPro:IPR041414"
FT                   /db_xref="InterPro:IPR042259"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC5"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACV60990.1"
FT                   /translation="MKYNVVFQPSGRRGMVVEGISLLQASRDLGADIEGPCGGTGKCGK
FT                   CKVKIEEGYFEKYSITSQSSNLLPLTEQEKAVLTPDEQLDHYRLACCAIIQGDVLVFVP
FT                   EQSSQAKQVILESSRGRSANLNPAVKKYYIEMKKATLDDYRDDYMRLKNALIENYSHLK
FT                   DEFSVDYKVLLTLPNVLRESGWKVTVTLWNERNVIAVEPGRVEEAYGIAVDIGTTTIAA
FT                   YLCDLNTGMLLKRDSLMNSQVRYGDDVISRISYCMMNEDGLARLHNLIIEDINKLIERM
FT                   AEAAHVNCENIYELVLVFNTAMHHITLNIDPRYMGSSPFVSVIREPVDIKARELGIKIA
FT                   EGGNVHCLPVEAGFVGADNVSVLIAEEPYKQDKMMLLIDIGTNGEINLGNRDCIMSTSC
FT                   ATGPALEGAQIKHGMRAAPGAIEGVKIDRHSFEPECKVIGGGVNSSSQTGYIKGICGSG
FT                   IIDAVACLFKAGIILPDGSFNKKLDIPRLRRSSEGKMEYVLVWAAETSAGQDITITQKD
FT                   VRAVQLAKAALYAGAKILMQKRDVNKLDGVVLAGAFGSYINKESALLIGMFPDCALENV
FT                   IAVGNAAGEGARLALLDKDKRLEAKEAASFVKFVETAAEADFQKHFFEAMYFPHAKDSF
FT                   PHMQNILDGEEK"
     MKYNVVFQPS GRRGMVVEGI SLLQASRDLG ADIEGPCGGT GKCGKCKVKI EEGYFEKYSI        60
     TSQSSNLLPL TEQEKAVLTP DEQLDHYRLA CCAIIQGDVL VFVPEQSSQA KQVILESSRG       120
     RSANLNPAVK KYYIEMKKAT LDDYRDDYMR LKNALIENYS HLKDEFSVDY KVLLTLPNVL       180
     RESGWKVTVT LWNERNVIAV EPGRVEEAYG IAVDIGTTTI AAYLCDLNTG MLLKRDSLMN       240
     SQVRYGDDVI SRISYCMMNE DGLARLHNLI IEDINKLIER MAEAAHVNCE NIYELVLVFN       300
     TAMHHITLNI DPRYMGSSPF VSVIREPVDI KARELGIKIA EGGNVHCLPV EAGFVGADNV       360
     SVLIAEEPYK QDKMMLLIDI GTNGEINLGN RDCIMSTSCA TGPALEGAQI KHGMRAAPGA       420
     IEGVKIDRHS FEPECKVIGG GVNSSSQTGY IKGICGSGII DAVACLFKAG IILPDGSFNK       480
     KLDIPRLRRS SEGKMEYVLV WAAETSAGQD ITITQKDVRA VQLAKAALYA GAKILMQKRD       540
     VNKLDGVVLA GAFGSYINKE SALLIGMFPD CALENVIAVG NAAGEGARLA LLDKDKRLEA       600
     KEAASFVKFV ETAAEADFQK HFFEAMYFPH AKDSFPHMQN ILDGEEK                     647
//

If you have problems or comments...

PBIL Back to PBIL home page