(data stored in ACNUC7421 zone)

EMBL: CP001720.PE250

CP001720.PE250       Location/Qualifiers
FT   CDS             287201..287674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0262"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: gur:Gura_4164 2C-methyl-D-erythritol 2,4-
FT                   cyclodiphosphate synthase; TIGRFAM: 2C-methyl-D-erythritol
FT                   2,4- cyclodiphosphate synthase; PFAM: MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61215"
FT                   /db_xref="GOA:C8W3W1"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W1"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ACV61215.1"
FT                   /translation="MRIGFGYDVHRLVPGRLLVLGGVNIPYELGLLGHSDADVLVHAMM
FT                   DALLGAASAGDIGRHFPDQDSRYKDASSLLLLSEVLRIITNKGYKVGNIDSVIVAQKPK
FT                   LAAFIPGMTDNIAAVLQVSSDQVNIKATTTEGLGFAGAGEGIASYSSVLLYSI"
     MRIGFGYDVH RLVPGRLLVL GGVNIPYELG LLGHSDADVL VHAMMDALLG AASAGDIGRH        60
     FPDQDSRYKD ASSLLLLSEV LRIITNKGYK VGNIDSVIVA QKPKLAAFIP GMTDNIAAVL       120
     QVSSDQVNIK ATTTEGLGFA GAGEGIASYS SVLLYSI                                157
//

If you have problems or comments...

PBIL Back to PBIL home page