(data stored in ACNUC7421 zone)

EMBL: CP001720.PE252

CP001720.PE252       Location/Qualifiers
FT   CDS             289257..289937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0264"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   baa:BA_0677 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61217"
FT                   /db_xref="GOA:C8W3W3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W3"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ACV61217.1"
FT                   /translation="MFDRLRNEIRAVFERDPAAKNILEVILCYPGLHAILIHRIAHSLY
FT                   KKRWFVLARFISQISRFLTGIEIHPGAKIGEGLFIDHGSGVVIGETTEIGDNVTIYQGV
FT                   TLGGTGKEKGKRHPTIGNNVVISAGARILGSFEVGDNAKIGAGSVVLKAVPSNSTVVGV
FT                   PGKIVVRDGQRVGDTHSNIDLRHDQLPDPISEMLLVMQGRINDLEDRLKAHEKKDGISN
FT                   KLEL"
     MFDRLRNEIR AVFERDPAAK NILEVILCYP GLHAILIHRI AHSLYKKRWF VLARFISQIS        60
     RFLTGIEIHP GAKIGEGLFI DHGSGVVIGE TTEIGDNVTI YQGVTLGGTG KEKGKRHPTI       120
     GNNVVISAGA RILGSFEVGD NAKIGAGSVV LKAVPSNSTV VGVPGKIVVR DGQRVGDTHS       180
     NIDLRHDQLP DPISEMLLVM QGRINDLEDR LKAHEKKDGI SNKLEL                      226
//

If you have problems or comments...

PBIL Back to PBIL home page