(data stored in ACNUC7421 zone)

EMBL: CP001720.PE253

CP001720.PE253       Location/Qualifiers
FT   CDS             289968..291470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0265"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: baa:BA_0678 tRNA synthetases class I (C);
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia ; Cysteinyl-tRNA synthetase class Ia
FT                   DALR; tRNA synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61218"
FT                   /db_xref="GOA:C8W3W4"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W4"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ACV61218.1"
FT                   /translation="MLLYNTLSRQKEEFVPAIPGRVSMYVCGPTTYNFIHLGNARPLVF
FT                   FDTVRRYLIYKGYQVLYVQNFTDIDDKIIKRAAEEKLDPSALAFKYTEEYYIDATSLNV
FT                   MMADIHPKVSDHMAEIIELVEKLVQKGFAYQSDGDVYFEVRRFKDYGKLSGRALEDMLA
FT                   GARVEVNEKKRDPMDFALWKAAKPGEPSWNSPWGQGRPGWHIECSAMSLKYLGENFDMH
FT                   GGGADLIFPHHENEIAQSEAATGEPLARYWLHNGFITVNQEKMSKSLGNFFLVREILDK
FT                   FSPEVVRFFLLGTHYRSPLDFDDEKLAVVEKGLDRIRTSIQLLGEACQRAGVDFSMINA
FT                   KEKPARVTSIIDTRHSSMKAFIKIKTSFEQAMEDDFNTALAVGSLFELAKETNILVQSL
FT                   GPKISEQEKACLLQAAELFKLFNQVLGIFKEDLCTGYPLVTPVDESGDGMLEAVMQMLL
FT                   DIRNEARKNKNWALSDRIRDALKDINVILEDTPQGTRWKKQA"
     MLLYNTLSRQ KEEFVPAIPG RVSMYVCGPT TYNFIHLGNA RPLVFFDTVR RYLIYKGYQV        60
     LYVQNFTDID DKIIKRAAEE KLDPSALAFK YTEEYYIDAT SLNVMMADIH PKVSDHMAEI       120
     IELVEKLVQK GFAYQSDGDV YFEVRRFKDY GKLSGRALED MLAGARVEVN EKKRDPMDFA       180
     LWKAAKPGEP SWNSPWGQGR PGWHIECSAM SLKYLGENFD MHGGGADLIF PHHENEIAQS       240
     EAATGEPLAR YWLHNGFITV NQEKMSKSLG NFFLVREILD KFSPEVVRFF LLGTHYRSPL       300
     DFDDEKLAVV EKGLDRIRTS IQLLGEACQR AGVDFSMINA KEKPARVTSI IDTRHSSMKA       360
     FIKIKTSFEQ AMEDDFNTAL AVGSLFELAK ETNILVQSLG PKISEQEKAC LLQAAELFKL       420
     FNQVLGIFKE DLCTGYPLVT PVDESGDGML EAVMQMLLDI RNEARKNKNW ALSDRIRDAL       480
     KDINVILEDT PQGTRWKKQA                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page