(data stored in ACNUC7421 zone)

EMBL: CP001720.PE256

CP001720.PE256       Location/Qualifiers
FT   CDS             292866..293378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0268"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   bha:BH0114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61221"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W7"
FT                   /inference="protein motif:PFAM:PF05991"
FT                   /protein_id="ACV61221.1"
FT                   /translation="MKEYLVIDGYNVIYTWPKLARLSDTSLEHARVKLVDIMASHSALS
FT                   GQLIKVVFDAHQVKNITQRQEQVNGIEILYTQQGETADALIERITGDLIKLGKVYVVTS
FT                   DWDEQRIIFGRGAYRMTPRELWEQVKKIRQKNMSEYSINLPTEGYLENRLNESVRDLLE
FT                   KLRRKKF"
     MKEYLVIDGY NVIYTWPKLA RLSDTSLEHA RVKLVDIMAS HSALSGQLIK VVFDAHQVKN        60
     ITQRQEQVNG IEILYTQQGE TADALIERIT GDLIKLGKVY VVTSDWDEQR IIFGRGAYRM       120
     TPRELWEQVK KIRQKNMSEY SINLPTEGYL ENRLNESVRD LLEKLRRKKF                  170
//

If you have problems or comments...

PBIL Back to PBIL home page