(data stored in ACNUC7421 zone)

EMBL: CP001720.PE257

CP001720.PE257       Location/Qualifiers
FT   CDS             293571..294215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0269"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-H factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bha:BH0115 RNA polymerase factor sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61222"
FT                   /db_xref="GOA:C8W3W8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3W8"
FT                   /inference="protein motif:TFAM:TIGR02859"
FT                   /protein_id="ACV61222.1"
FT                   /translation="MIISAQREEIAGFEVLIDEDVVEFAREGDDIALEYLINKYKNFVR
FT                   AKARSYFLIGADREDIIQEGMIGLYKAIRDFRMDKLSSFRAFAELCITRQIITAIKTAT
FT                   RQKHIPLNSYVSLNKPIYDDDSDRTLLDVISGTKITDPEELIISREEFDDIEEKMGEIL
FT                   SSLEWKVLMSYLEGKSYQEIAEDLKRHVKSIDNALQRVKRKLERYLEKREI"
     MIISAQREEI AGFEVLIDED VVEFAREGDD IALEYLINKY KNFVRAKARS YFLIGADRED        60
     IIQEGMIGLY KAIRDFRMDK LSSFRAFAEL CITRQIITAI KTATRQKHIP LNSYVSLNKP       120
     IYDDDSDRTL LDVISGTKIT DPEELIISRE EFDDIEEKMG EILSSLEWKV LMSYLEGKSY       180
     QEIAEDLKRH VKSIDNALQR VKRKLERYLE KREI                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page