(data stored in ACNUC7421 zone)

EMBL: CP001720.PE26

CP001720.PE26        Location/Qualifiers
FT   CDS             29729..30565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0027"
FT                   /product="Pyrrolysine-tRNA ligase"
FT                   /note="PFAM: tRNA synthetase class II (G H P and S); KEGG:
FT                   wpi:WPa_1006 threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60991"
FT                   /db_xref="GOA:C8VVC8"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR023877"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC8"
FT                   /inference="protein motif:PRIAM:6.1.1.26"
FT                   /protein_id="ACV60991.1"
FT                   /translation="MSFLWTVSQQKRLSELNASEEEKNMSFSSTSDREAAYKRVEMRLI
FT                   NESKQRLNKLRHETKRPAICALENRLAAALRGAGFVQVATPVILSKKLLGKMTITDEHA
FT                   LFSQVFWIEENKCLRPMLAPNLYYILKDLLRLWEKPVRIFEIGSCFRKESQGSNHLNEF
FT                   TMLNLVEWGLPEEQRQKRISELAKLVMDETGIDEYHLEHAESVVYGETVDVMHRDIELG
FT                   SGALGPHFLDGRWGVVGPWVGIGFGLERLLMVEQGGQNVRSMGKSLTYLDGVRLNI"
     MSFLWTVSQQ KRLSELNASE EEKNMSFSST SDREAAYKRV EMRLINESKQ RLNKLRHETK        60
     RPAICALENR LAAALRGAGF VQVATPVILS KKLLGKMTIT DEHALFSQVF WIEENKCLRP       120
     MLAPNLYYIL KDLLRLWEKP VRIFEIGSCF RKESQGSNHL NEFTMLNLVE WGLPEEQRQK       180
     RISELAKLVM DETGIDEYHL EHAESVVYGE TVDVMHRDIE LGSGALGPHF LDGRWGVVGP       240
     WVGIGFGLER LLMVEQGGQN VRSMGKSLTY LDGVRLNI                               278
//

If you have problems or comments...

PBIL Back to PBIL home page