(data stored in ACNUC7421 zone)

EMBL: CP001720.PE262

CP001720.PE262       Location/Qualifiers
FT   CDS             297703..298128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0274"
FT                   /product="ribosomal protein L11"
FT                   /note="KEGG: bsu:BSU01020 50S ribosomal protein L11;
FT                   TIGRFAM: ribosomal protein L11; PFAM: ribosomal protein
FT                   L11; SMART: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61227"
FT                   /db_xref="GOA:C8W3X3"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X3"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ACV61227.1"
FT                   /translation="MAKRVKAIVKLQINAGKATPAPPVGPALGQHGVNIMGFVKEYNER
FT                   TAKNAGLVIPVEITIYEDRTFSFVTKTPPAAVLLKKAAGIETASGQPNRTKVGKVSKDQ
FT                   VKEIAQLKMPDLNAASLEAAMSMVEGTARSMGIVVEG"
     MAKRVKAIVK LQINAGKATP APPVGPALGQ HGVNIMGFVK EYNERTAKNA GLVIPVEITI        60
     YEDRTFSFVT KTPPAAVLLK KAAGIETASG QPNRTKVGKV SKDQVKEIAQ LKMPDLNAAS       120
     LEAAMSMVEG TARSMGIVVE G                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page