(data stored in ACNUC7421 zone)

EMBL: CP001720.PE264

CP001720.PE264       Location/Qualifiers
FT   CDS             299090..299617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0276"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: gbm:Gbem_0924
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61229"
FT                   /db_xref="GOA:C8W3X5"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X5"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ACV61229.1"
FT                   /translation="MPTKKEKEIFVEVVYDKMRSCKSAILADYRGLTVSAVTELRNKLR
FT                   ESNSDLKVAKNTLIKIAVDKIGIEGLDPYLEGPTAIAFGYDDPVAPAKILSEFARTNKD
FT                   LEIKGGVLEGRVITADGVKGLASLPSREVLLGKVLGGMQAPLYGFANVLQGNIRNFVYV
FT                   LEAVRKQKAGEA"
     MPTKKEKEIF VEVVYDKMRS CKSAILADYR GLTVSAVTEL RNKLRESNSD LKVAKNTLIK        60
     IAVDKIGIEG LDPYLEGPTA IAFGYDDPVA PAKILSEFAR TNKDLEIKGG VLEGRVITAD       120
     GVKGLASLPS REVLLGKVLG GMQAPLYGFA NVLQGNIRNF VYVLEAVRKQ KAGEA            175
//

If you have problems or comments...

PBIL Back to PBIL home page