(data stored in ACNUC7421 zone)

EMBL: CP001720.PE268

CP001720.PE268       Location/Qualifiers
FT   CDS             307995..308243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0280"
FT                   /product="putative ribosomal protein L7Ae-like protein"
FT                   /note="KEGG: bsu:BSU01090 putative ribosomal protein L7Ae-
FT                   like"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61233"
FT                   /db_xref="GOA:C8W3X9"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3X9"
FT                   /inference="similar to AA sequence:KEGG:BSU01090"
FT                   /protein_id="ACV61233.1"
FT                   /translation="MPYERLKLAQKKTVGLKQTLKACHRGNVECVYIATDAEANVTAPV
FT                   QKLCQEKSIAVVKVKSMRDLGKACGIEVACAVAAAIK"
     MPYERLKLAQ KKTVGLKQTL KACHRGNVEC VYIATDAEAN VTAPVQKLCQ EKSIAVVKVK        60
     SMRDLGKACG IEVACAVAAA IK                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page