(data stored in ACNUC7421 zone)

EMBL: CP001720.PE269

CP001720.PE269       Location/Qualifiers
FT   CDS             308314..308688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0281"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: geo:Geob_3630 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61234"
FT                   /db_xref="GOA:C8W3Y0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y0"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ACV61234.1"
FT                   /translation="MPTINQLVHKGRSSLITKSTAPALKECPQKRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLTNGIEVTSYIPGIGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGALDT
FT                   AGVQNRNRSRSKYGTKRPKK"
     MPTINQLVHK GRSSLITKST APALKECPQK RGVCTRVYTT TPKKPNSALR KVARVRLTNG        60
     IEVTSYIPGI GHNLQEHSVV LVRGGRVKDL PGVRYHIVRG ALDTAGVQNR NRSRSKYGTK       120
     RPKK                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page