(data stored in ACNUC7421 zone)

EMBL: CP001720.PE270

CP001720.PE270       Location/Qualifiers
FT   CDS             308736..309206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0282"
FT                   /product="ribosomal protein S7"
FT                   /note="TIGRFAM: ribosomal protein S7; PFAM: ribosomal
FT                   protein S7; KEGG: bha:BH0130 30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61235"
FT                   /db_xref="GOA:C8W3Y1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y1"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ACV61235.1"
FT                   /translation="MPRRSRQTKRDVMQDPVYNNKIVTKLINQIMQSGKKGVAESIVYD
FT                   AFDIIKEKTGKDPLEVFDQALKNVMPVLEVKARRVGGANYQVPIEVRHDRRQTLAIRWL
FT                   TKYSRDRSGRTMRERLASEILDAAASTGATFKKKEDTHKMAEANKAFAHYRW"
     MPRRSRQTKR DVMQDPVYNN KIVTKLINQI MQSGKKGVAE SIVYDAFDII KEKTGKDPLE        60
     VFDQALKNVM PVLEVKARRV GGANYQVPIE VRHDRRQTLA IRWLTKYSRD RSGRTMRERL       120
     ASEILDAAAS TGATFKKKED THKMAEANKA FAHYRW                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page