(data stored in ACNUC7421 zone)

EMBL: CP001720.PE273

CP001720.PE273       Location/Qualifiers
FT   CDS             312867..313175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0285"
FT                   /product="ribosomal protein S10"
FT                   /note="TIGRFAM: ribosomal protein S10; PFAM: ribosomal
FT                   protein S10; KEGG: bha:BH0133 30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61238"
FT                   /db_xref="GOA:C8W3Y4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y4"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ACV61238.1"
FT                   /translation="MKNQKIRIRLKAYDHFMLDQSAKKIVETAKRTGAQVAGPIPLPTE
FT                   KNIYTILRSPHVNKDSREQFEMRTHKRLIDILEPTPKTVDSLMRLDLPAGVDIEIKL"
     MKNQKIRIRL KAYDHFMLDQ SAKKIVETAK RTGAQVAGPI PLPTEKNIYT ILRSPHVNKD        60
     SREQFEMRTH KRLIDILEPT PKTVDSLMRL DLPAGVDIEI KL                          102
//

If you have problems or comments...

PBIL Back to PBIL home page