(data stored in ACNUC7421 zone)

EMBL: CP001720.PE275

CP001720.PE275       Location/Qualifiers
FT   CDS             313886..314506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0287"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: bha:BH0135 50S
FT                   ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61240"
FT                   /db_xref="GOA:C8W3Y6"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y6"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ACV61240.1"
FT                   /translation="MPTVALFNIKGEQVGEVALKDEVFGIEVNESVLHDAVVMQLAGRR
FT                   QGTHDTKTRGEVRGGGKKPWRQKGTGRARHGTIRSPIWRGGGIVFGPHPRTYKYKLPKK
FT                   VRRLALKSALSSKVLAGNIKVLDALSMEMPKTKEMVGILKNLQVDKALLVIADKDMNVI
FT                   KSARNIPGIKPVGAAGVNVYDLLKHTTLVITKDAVSKVEEVLS"
     MPTVALFNIK GEQVGEVALK DEVFGIEVNE SVLHDAVVMQ LAGRRQGTHD TKTRGEVRGG        60
     GKKPWRQKGT GRARHGTIRS PIWRGGGIVF GPHPRTYKYK LPKKVRRLAL KSALSSKVLA       120
     GNIKVLDALS MEMPKTKEMV GILKNLQVDK ALLVIADKDM NVIKSARNIP GIKPVGAAGV       180
     NVYDLLKHTT LVITKDAVSK VEEVLS                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page