(data stored in ACNUC7421 zone)

EMBL: CP001720.PE276

CP001720.PE276       Location/Qualifiers
FT   CDS             314506..314790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0288"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: rbo:A1I_02045
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61241"
FT                   /db_xref="GOA:C8W3Y7"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y7"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ACV61241.1"
FT                   /translation="MEARDILRKPIVTEKTMALLEDNKYSFLVDIKANKSEIKKAVEQI
FT                   FKVKVEKVNTLIVKGKPKRVRNSVGRTSDVKKAIVKLREGDKIELFEGI"
     MEARDILRKP IVTEKTMALL EDNKYSFLVD IKANKSEIKK AVEQIFKVKV EKVNTLIVKG        60
     KPKRVRNSVG RTSDVKKAIV KLREGDKIEL FEGI                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page