(data stored in ACNUC7421 zone)

EMBL: CP001720.PE278

CP001720.PE278       Location/Qualifiers
FT   CDS             315691..315975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0290"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: bha:BH0138 30S ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61243"
FT                   /db_xref="GOA:C8W3Y9"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Y9"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ACV61243.1"
FT                   /translation="MGRSLKKGPYCEERLLSRIEKMNETGDKKVIKTWSRRSTIFPQMI
FT                   GHTIAVHDGRKHVPVYVTEDMVGHKLGEFSPTRTFRGHGSHTERSTSLK"
     MGRSLKKGPY CEERLLSRIE KMNETGDKKV IKTWSRRSTI FPQMIGHTIA VHDGRKHVPV        60
     YVTEDMVGHK LGEFSPTRTF RGHGSHTERS TSLK                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page