(data stored in ACNUC7421 zone)

EMBL: CP001720.PE28

CP001720.PE28        Location/Qualifiers
FT   CDS             31706..32866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0029"
FT                   /product="protein of unknown function DUF201"
FT                   /note="PFAM: protein of unknown function DUF201; KEGG:
FT                   abu:Abu_2250 ATP-grasp domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60993"
FT                   /db_xref="GOA:C8VVD0"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023890"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD0"
FT                   /inference="protein motif:PFAM:PF02655"
FT                   /protein_id="ACV60993.1"
FT                   /translation="MLVAIMGGKLQGVEAAYLSRQAGWKAVLVDRNRDAPAAGMCDNFI
FT                   QADLMEKDKLVDLFKKVKLVIPAVENSEVLENIKECALAAGVKIIYDSAAYALSSSKIE
FT                   SDKLFARLDLPVPKPWSGCGFPVVIKPSGASGSENVYKINSLRDFNELTLKLGNLDSWV
FT                   KQEYLRGPSYSIEVIGCKGDYQTFQITELEMDAAHDCKRVLAPAQLSTEKQDEFKSQAV
FT                   KIARALNLNGIMDVEVILHDEKFKVLEIDARLPSQTPTVVYKATGINMLEVLWPGGLKR
FT                   REKQEIGMTRGVVYEHIKVRSNRLIEVGGEHIMAGAGRLHILKKFFGADEAISNYDRDK
FT                   TEWVATLIITGKNRQEAWLKRTAVIKNIMQEFAVEDCMDTGISNKG"
     MLVAIMGGKL QGVEAAYLSR QAGWKAVLVD RNRDAPAAGM CDNFIQADLM EKDKLVDLFK        60
     KVKLVIPAVE NSEVLENIKE CALAAGVKII YDSAAYALSS SKIESDKLFA RLDLPVPKPW       120
     SGCGFPVVIK PSGASGSENV YKINSLRDFN ELTLKLGNLD SWVKQEYLRG PSYSIEVIGC       180
     KGDYQTFQIT ELEMDAAHDC KRVLAPAQLS TEKQDEFKSQ AVKIARALNL NGIMDVEVIL       240
     HDEKFKVLEI DARLPSQTPT VVYKATGINM LEVLWPGGLK RREKQEIGMT RGVVYEHIKV       300
     RSNRLIEVGG EHIMAGAGRL HILKKFFGAD EAISNYDRDK TEWVATLIIT GKNRQEAWLK       360
     RTAVIKNIMQ EFAVEDCMDT GISNKG                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page