(data stored in ACNUC7421 zone)

EMBL: CP001720.PE282

CP001720.PE282       Location/Qualifiers
FT   CDS             317440..317649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0294"
FT                   /product="ribosomal protein L29"
FT                   /note="TIGRFAM: ribosomal protein L29; PFAM: ribosomal
FT                   protein L29; KEGG: bha:BH0142 50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61247"
FT                   /db_xref="GOA:C8W3Z3"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z3"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ACV61247.1"
FT                   /translation="MKAKDKAKELREMTEDELNRKLTDSKDELFKLRFQLATGQLDNPM
FT                   KLKEVRRRMAKVKTIIRERELGIR"
     MKAKDKAKEL REMTEDELNR KLTDSKDELF KLRFQLATGQ LDNPMKLKEV RRRMAKVKTI        60
     IRERELGIR                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page