(data stored in ACNUC7421 zone)

EMBL: CP001720.PE283

CP001720.PE283       Location/Qualifiers
FT   CDS             317676..317939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0295"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: gme:Gmet_0635 30S
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61248"
FT                   /db_xref="GOA:C8W3Z4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z4"
FT                   /inference="protein motif:PFAM:PF00366"
FT                   /protein_id="ACV61248.1"
FT                   /translation="MEERNNRKIRVGRVVSNKMDKTVVVSVETITPHKLYNKTIRTSKK
FT                   FKAHDEENSCRTGDTVRIMETRPLSKEKRWRVIEILERGKQI"
     MEERNNRKIR VGRVVSNKMD KTVVVSVETI TPHKLYNKTI RTSKKFKAHD EENSCRTGDT        60
     VRIMETRPLS KEKRWRVIEI LERGKQI                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page