(data stored in ACNUC7421 zone)

EMBL: CP001720.PE284

CP001720.PE284       Location/Qualifiers
FT   CDS             317983..318351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0296"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: bha:BH0144 50S ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61249"
FT                   /db_xref="GOA:C8W3Z5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z5"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ACV61249.1"
FT                   /translation="MIQAETRLNVADNTGARKLLCIRVLGGAHRKYARIGDTIVCSVKE
FT                   ATPGGVVKKGDVVKAVVVRTKKELRRNDGTYIKFDENAAVIIKDDKSPRGTRIFGPVAR
FT                   ELRDKDYMKIVSLAPEVI"
     MIQAETRLNV ADNTGARKLL CIRVLGGAHR KYARIGDTIV CSVKEATPGG VVKKGDVVKA        60
     VVVRTKKELR RNDGTYIKFD ENAAVIIKDD KSPRGTRIFG PVARELRDKD YMKIVSLAPE       120
     VI                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page