(data stored in ACNUC7421 zone)

EMBL: CP001720.PE285

CP001720.PE285       Location/Qualifiers
FT   CDS             318414..318734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0297"
FT                   /product="ribosomal protein L24"
FT                   /note="KEGG: sfu:Sfum_1566 ribosomal protein L24; TIGRFAM:
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61250"
FT                   /db_xref="GOA:C8W3Z6"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z6"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ACV61250.1"
FT                   /translation="MPKVHVRKGDTVLVLSGKSEGKKGKIISVLPKKERVIVEGLNKVK
FT                   RHTKPTQTMPQGGIVEKEAPIHSSNVMLICNRCSKPTRIGKRVLDDGKKVRTCKKCGEV
FT                   ID"
     MPKVHVRKGD TVLVLSGKSE GKKGKIISVL PKKERVIVEG LNKVKRHTKP TQTMPQGGIV        60
     EKEAPIHSSN VMLICNRCSK PTRIGKRVLD DGKKVRTCKK CGEVID                      106
//

If you have problems or comments...

PBIL Back to PBIL home page