(data stored in ACNUC7421 zone)

EMBL: CP001720.PE286

CP001720.PE286       Location/Qualifiers
FT   CDS             318762..319304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0298"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: bha:BH0146 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61251"
FT                   /db_xref="GOA:C8W3Z7"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z7"
FT                   /inference="protein motif:PFAM:PF00281"
FT                   /protein_id="ACV61251.1"
FT                   /translation="MVRLKDKYNNEIVSAMQNKFGYKNIMEVPKLEKVVVNMGVGEAAQ
FT                   NSKAIDAAVGDMVKITGQKPIVTKAKKSIAAFKLRAGMPIGCKTTLRGERMYEFADKLV
FT                   SIVLPRVRDFRGVSPKSFDGRGNYTLGLREQIIFPEIEYDKVDKIRGMDIIFVTTAKTD
FT                   EEGRELLRLMGMPFKAN"
     MVRLKDKYNN EIVSAMQNKF GYKNIMEVPK LEKVVVNMGV GEAAQNSKAI DAAVGDMVKI        60
     TGQKPIVTKA KKSIAAFKLR AGMPIGCKTT LRGERMYEFA DKLVSIVLPR VRDFRGVSPK       120
     SFDGRGNYTL GLREQIIFPE IEYDKVDKIR GMDIIFVTTA KTDEEGRELL RLMGMPFKAN       180
//

If you have problems or comments...

PBIL Back to PBIL home page