(data stored in ACNUC7421 zone)

EMBL: CP001720.PE287

CP001720.PE287       Location/Qualifiers
FT   CDS             319334..319519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0299"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: dvl:Dvul_1752 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61252"
FT                   /db_xref="GOA:C8W3Z8"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:C8W3Z8"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ACV61252.1"
FT                   /translation="MAKTSMKIKAQRASKFKVRDHNRCKLCGRPHAYLRKFGICRICFR
FT                   ELAYKGEIPGIRKASW"
     MAKTSMKIKA QRASKFKVRD HNRCKLCGRP HAYLRKFGIC RICFRELAYK GEIPGIRKAS        60
     W                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page