(data stored in ACNUC7421 zone)

EMBL: CP001720.PE290

CP001720.PE290       Location/Qualifiers
FT   CDS             320552..320920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0302"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: bsu:BSU01320 50S ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61255"
FT                   /db_xref="GOA:C8W401"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:C8W401"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ACV61255.1"
FT                   /translation="MISKIDRSVEREKRRRRVRKKVSGTGSRPRLNVFRSLNHIYAQIV
FT                   DDEKGITLATASSLEPEVKSKLDSYGNVVAALAVGELIAKKALEKGINTVVFDRAGYLY
FT                   HGRVKALAEAARKGGLEF"
     MISKIDRSVE REKRRRRVRK KVSGTGSRPR LNVFRSLNHI YAQIVDDEKG ITLATASSLE        60
     PEVKSKLDSY GNVVAALAVG ELIAKKALEK GINTVVFDRA GYLYHGRVKA LAEAARKGGL       120
     EF                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page