(data stored in ACNUC7421 zone)

EMBL: CP001720.PE291

CP001720.PE291       Location/Qualifiers
FT   CDS             320943..321443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0303"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: Ribosomal
FT                   protein S5 ; ribosomal protein S5 domain protein; KEGG:
FT                   bha:BH0151 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61256"
FT                   /db_xref="GOA:C8W402"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C8W402"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ACV61256.1"
FT                   /translation="MAAIDPNKLELSEKIVYINRVAKVVKGGRRFSFSALVVVGDGNGH
FT                   VGAGLGKAGEVPEAIRKGIEDAKKHLIRIPLSGTTIPHEVIGRFGAGRVLLKPASAGTG
FT                   VIAGGPVRAILELGGVRDILTKSLGSNNANNMVHATMAAIESLKTPEEVARSRGKTLEE
FT                   LLS"
     MAAIDPNKLE LSEKIVYINR VAKVVKGGRR FSFSALVVVG DGNGHVGAGL GKAGEVPEAI        60
     RKGIEDAKKH LIRIPLSGTT IPHEVIGRFG AGRVLLKPAS AGTGVIAGGP VRAILELGGV       120
     RDILTKSLGS NNANNMVHAT MAAIESLKTP EEVARSRGKT LEELLS                      166
//

If you have problems or comments...

PBIL Back to PBIL home page