(data stored in ACNUC7421 zone)

EMBL: CP001720.PE293

CP001720.PE293       Location/Qualifiers
FT   CDS             321647..322087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0305"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; PFAM: ribosomal
FT                   protein L15; KEGG: bha:BH0153 50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61258"
FT                   /db_xref="GOA:C8W404"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:C8W404"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ACV61258.1"
FT                   /translation="MFLHEIKPNPGARKEPKRKGQGIGSGNGKTAGRGHKGQNARSGGG
FT                   VRPGFEGGQMPLQRRLPKRGFNNIFAKEIAAINVDDLNRFENGETITPEMLKECRLIRK
FT                   FKDGVKILGHGELKKSLTVQANAFSKAAVEKIEAAGGKAEVI"
     MFLHEIKPNP GARKEPKRKG QGIGSGNGKT AGRGHKGQNA RSGGGVRPGF EGGQMPLQRR        60
     LPKRGFNNIF AKEIAAINVD DLNRFENGET ITPEMLKECR LIRKFKDGVK ILGHGELKKS       120
     LTVQANAFSK AAVEKIEAAG GKAEVI                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page