(data stored in ACNUC7421 zone)

EMBL: CP001720.PE294

CP001720.PE294       Location/Qualifiers
FT   CDS             322089..323354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0306"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: sfu:Sfum_1575 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61259"
FT                   /db_xref="GOA:C8W405"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:C8W405"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ACV61259.1"
FT                   /translation="MLNGLQSAFKIGELRNKLLFTLAMLFVFRLGAHIPVPGVNPSVIA
FT                   DLIKSGALFGFFDVISGGAFKNFSILAMSITPYINASIIMQLLTVVIPHLEKLAKEGEE
FT                   GRRKITQITRYTTAVLAFIQGIGMVFALRNKGILLHPNVTSYLTVAISLTAGTVFLMWL
FT                   GEQITEKGIGNGISLLIFAGIVSRVPAGIVNIVQYFKTGTINIFSVLGLIIIGAAVIAA
FT                   IVAVQEGQRRIPVQYAKRVVGRRVYGGQTTHIPLKVNQAGVIPVIFASSILLFPQTVAG
FT                   WFAGHAVADWFLSVFTWGSFLHTVFYALLVIGFTYFYTAVIMNPIDIADNIKKYGGFIP
FT                   GLRPGRPTAEYIGRVMSRVTLAGAVFLAIIAILPNFVLLATRIPNIYFGGTALLIVVGV
FT                   ALDTMKQVESHLLMRSYQGFIK"
     MLNGLQSAFK IGELRNKLLF TLAMLFVFRL GAHIPVPGVN PSVIADLIKS GALFGFFDVI        60
     SGGAFKNFSI LAMSITPYIN ASIIMQLLTV VIPHLEKLAK EGEEGRRKIT QITRYTTAVL       120
     AFIQGIGMVF ALRNKGILLH PNVTSYLTVA ISLTAGTVFL MWLGEQITEK GIGNGISLLI       180
     FAGIVSRVPA GIVNIVQYFK TGTINIFSVL GLIIIGAAVI AAIVAVQEGQ RRIPVQYAKR       240
     VVGRRVYGGQ TTHIPLKVNQ AGVIPVIFAS SILLFPQTVA GWFAGHAVAD WFLSVFTWGS       300
     FLHTVFYALL VIGFTYFYTA VIMNPIDIAD NIKKYGGFIP GLRPGRPTAE YIGRVMSRVT       360
     LAGAVFLAII AILPNFVLLA TRIPNIYFGG TALLIVVGVA LDTMKQVESH LLMRSYQGFI       420
     K                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page