(data stored in ACNUC7421 zone)

EMBL: CP001720.PE295

CP001720.PE295       Location/Qualifiers
FT   CDS             323374..324123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0307"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: bha:BH0156 methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61260"
FT                   /db_xref="GOA:C8W406"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C8W406"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ACV61260.1"
FT                   /translation="MITCKSERELMYMREAGKIAAEALAKLAGAVQPGVTTKELDRLAE
FT                   EYIRSCGARPAFKGLYGFPATICSSVNEEVVHGIPGLRKLENGDIISIDIGTEVNGYFG
FT                   DCAVTLAVGKVSDEAWRLIKVTEESFYAGIAKAKIGNRLSDISNAVQKYVEEHGFSVVR
FT                   DYVGHGIGSSMHEEPQVPNFGKPGRGPRLQAGMTLAIEPMVNMGTYEVRTLPDNWTVVT
FT                   KDRKLSSHYEHTIAITDNEPEILTRLK"
     MITCKSEREL MYMREAGKIA AEALAKLAGA VQPGVTTKEL DRLAEEYIRS CGARPAFKGL        60
     YGFPATICSS VNEEVVHGIP GLRKLENGDI ISIDIGTEVN GYFGDCAVTL AVGKVSDEAW       120
     RLIKVTEESF YAGIAKAKIG NRLSDISNAV QKYVEEHGFS VVRDYVGHGI GSSMHEEPQV       180
     PNFGKPGRGP RLQAGMTLAI EPMVNMGTYE VRTLPDNWTV VTKDRKLSSH YEHTIAITDN       240
     EPEILTRLK                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page