(data stored in ACNUC7421 zone)

EMBL: CP001720.PE296

CP001720.PE296       Location/Qualifiers
FT   CDS             324166..324447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH0157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61261"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:C8W407"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61261.1"
FT                   /translation="MSGKLKIGQLVQSVSGRDAGKYYLVWDVADTSRALLVDGLGRKAD
FT                   RPKKKNVKHLKAYPVIIDEIEKELLAGQRVSDLEVHKALEILIKNRTR"
     MSGKLKIGQL VQSVSGRDAG KYYLVWDVAD TSRALLVDGL GRKADRPKKK NVKHLKAYPV        60
     IIDEIEKELL AGQRVSDLEV HKALEILIKN RTR                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page