(data stored in ACNUC7421 zone)

EMBL: CP001720.PE302

CP001720.PE302       Location/Qualifiers
FT   CDS             326359..327306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0314"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: bha:BH0162 DNA-directed RNA polymerase subunit
FT                   alpha; TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase insert; RNA polymerase alpha subunit
FT                   domain protein; RNA polymerase dimerisation; SMART: RNA
FT                   polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61267"
FT                   /db_xref="GOA:C8W413"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:C8W413"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ACV61267.1"
FT                   /translation="MQIEKPRIECVETNEDNTYGKFIVEPLERGYGITLGNSLRRILLS
FT                   SLPGVAVTSVKIDGVLHEFSTVPGVREDVTDIILNLKSLRLKMHGEADEKILRIEAQGE
FT                   GEVRAGDIVPDSDVEILNPDMYIATLAANGRLSMDITIARGRGYFSAERNKKGEPIIGV
FT                   IPIDSIFTPVYKVNYSVENTRVGQRTDYDKLSIEIWTDGSIHPDEAASLAAKIMSEHLQ
FT                   LFIGLTEETKDVEIMVEKEEEKKDKIMEMTIEELDLSVRSYNCLKRACINTVEELIQRN
FT                   EEDMMKVRNLGKKSLEEVIQKLNELGVSLKESEE"
     MQIEKPRIEC VETNEDNTYG KFIVEPLERG YGITLGNSLR RILLSSLPGV AVTSVKIDGV        60
     LHEFSTVPGV REDVTDIILN LKSLRLKMHG EADEKILRIE AQGEGEVRAG DIVPDSDVEI       120
     LNPDMYIATL AANGRLSMDI TIARGRGYFS AERNKKGEPI IGVIPIDSIF TPVYKVNYSV       180
     ENTRVGQRTD YDKLSIEIWT DGSIHPDEAA SLAAKIMSEH LQLFIGLTEE TKDVEIMVEK       240
     EEEKKDKIME MTIEELDLSV RSYNCLKRAC INTVEELIQR NEEDMMKVRN LGKKSLEEVI       300
     QKLNELGVSL KESEE                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page