(data stored in ACNUC7421 zone)

EMBL: CP001720.PE304

CP001720.PE304       Location/Qualifiers
FT   CDS             327675..328508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0316"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sat:SYN_00209 ABC-type cobalt transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61269"
FT                   /db_xref="GOA:C8W415"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:C8W415"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61269.1"
FT                   /translation="MQKVLFQLNDLCFSYFQRTIEKQVLNFINKQVRAGEYLALIGGNG
FT                   SGKTTLAKHLNGLLLPTSGSLAVDGMDTANQNNLLAVRQTVGMVFQNPDNQIVASVVEE
FT                   DVAFGPENLGVDAAEIKQRVVMALETVGLAGYRNFTPDFLSGGEKQRLALAGVLAMKPK
FT                   CLVLDEATSMLDCAGRYRLLKIISNLHKETGLTVVNITHDMNEAALSDRIWVLNKGQII
FT                   LDGPPRKVFQQRELLHECGLDLPDIPEICRRLSISGLAVPLDLLDSEDLVNYLCQ"
     MQKVLFQLND LCFSYFQRTI EKQVLNFINK QVRAGEYLAL IGGNGSGKTT LAKHLNGLLL        60
     PTSGSLAVDG MDTANQNNLL AVRQTVGMVF QNPDNQIVAS VVEEDVAFGP ENLGVDAAEI       120
     KQRVVMALET VGLAGYRNFT PDFLSGGEKQ RLALAGVLAM KPKCLVLDEA TSMLDCAGRY       180
     RLLKIISNLH KETGLTVVNI THDMNEAALS DRIWVLNKGQ IILDGPPRKV FQQRELLHEC       240
     GLDLPDIPEI CRRLSISGLA VPLDLLDSED LVNYLCQ                                277
//

If you have problems or comments...

PBIL Back to PBIL home page