(data stored in ACNUC7421 zone)

EMBL: CP001720.PE305

CP001720.PE305       Location/Qualifiers
FT   CDS             328499..329350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0317"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bsu:BSU01460 cobalt transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61270"
FT                   /db_xref="GOA:C8W416"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:C8W416"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61270.1"
FT                   /translation="MSIIEFCSVDQIYHAGTSIQKKSLSAVSFNVEQGEMVAVVGATGS
FT                   GKSTLVQHINGILLPYKGQVLVKGVATSEKKHRRSLWRMVGLVFQYPENQLFEDTVYKD
FT                   VAFGPRNLKLPNTEVDRRVRYALKKVGLDYEFIKDESPLNLSGGQKRRVAVAGVLAIEP
FT                   EILVLDEPTAGLEPRVAIDLLRHLKELQLENNTTVLIVTHNLKEVASMVDRVLVLHQAK
FT                   VLFSGTPRELYSRYYNLPGSGLALPPALELMLGLEKRGKKVRTDVLTIDEAVAEILKAC
FT                   KK"
     MSIIEFCSVD QIYHAGTSIQ KKSLSAVSFN VEQGEMVAVV GATGSGKSTL VQHINGILLP        60
     YKGQVLVKGV ATSEKKHRRS LWRMVGLVFQ YPENQLFEDT VYKDVAFGPR NLKLPNTEVD       120
     RRVRYALKKV GLDYEFIKDE SPLNLSGGQK RRVAVAGVLA IEPEILVLDE PTAGLEPRVA       180
     IDLLRHLKEL QLENNTTVLI VTHNLKEVAS MVDRVLVLHQ AKVLFSGTPR ELYSRYYNLP       240
     GSGLALPPAL ELMLGLEKRG KKVRTDVLTI DEAVAEILKA CKK                         283
//

If you have problems or comments...

PBIL Back to PBIL home page