(data stored in ACNUC7421 zone)

EMBL: CP001720.PE306

CP001720.PE306       Location/Qualifiers
FT   CDS             329368..330156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0318"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: baa:BA_0724
FT                   cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61271"
FT                   /db_xref="GOA:C8W417"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C8W417"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ACV61271.1"
FT                   /translation="MREGISFGRYLPGNSFIHFLDPRAKLIASLFIGASVFLAESWFKL
FT                   IALSVISIVIVYLSEIQPKIILRAWSALWLFMIFLLIFQLLFTPGSIIIKWGWFKVTRE
FT                   GISLGGMLLLRMTLVMTLASVLTFTTSPVSIAGAMEMLLQPLKKIKFPVHELSLMMTVA
FT                   IRFLPTIYGEAVRIINAQKSRGAAGGQSGIAGIYKTVIPIIVPLFAGVFRRAEELALAM
FT                   EARCYHGGEGRSSYIQYKYNKKDYIVISVGLLILFLAVWK"
     MREGISFGRY LPGNSFIHFL DPRAKLIASL FIGASVFLAE SWFKLIALSV ISIVIVYLSE        60
     IQPKIILRAW SALWLFMIFL LIFQLLFTPG SIIIKWGWFK VTREGISLGG MLLLRMTLVM       120
     TLASVLTFTT SPVSIAGAME MLLQPLKKIK FPVHELSLMM TVAIRFLPTI YGEAVRIINA       180
     QKSRGAAGGQ SGIAGIYKTV IPIIVPLFAG VFRRAEELAL AMEARCYHGG EGRSSYIQYK       240
     YNKKDYIVIS VGLLILFLAV WK                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page