(data stored in ACNUC7421 zone)

EMBL: CP001720.PE308

CP001720.PE308       Location/Qualifiers
FT   CDS             331058..331504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0320"
FT                   /product="ribosomal protein L13"
FT                   /note="TIGRFAM: ribosomal protein L13; PFAM: ribosomal
FT                   protein L13; KEGG: abo:ABO_0576 50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61273"
FT                   /db_xref="GOA:C8W419"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:C8W419"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ACV61273.1"
FT                   /translation="MKTFMAKSNEIKRKWWVIDGEGKVLGRLAVEVAKILRGKHHPLYT
FT                   PHVDTGDNVIIVNADKVILTGKKMQQKQYIRHSGYPGGIKMTNYETMMQKNPELMVTKA
FT                   VKGMLPHNSLGRSMIKKLKVYKGSEHPHEAQKPEVWPLSSEGGI"
     MKTFMAKSNE IKRKWWVIDG EGKVLGRLAV EVAKILRGKH HPLYTPHVDT GDNVIIVNAD        60
     KVILTGKKMQ QKQYIRHSGY PGGIKMTNYE TMMQKNPELM VTKAVKGMLP HNSLGRSMIK       120
     KLKVYKGSEH PHEAQKPEVW PLSSEGGI                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page