(data stored in ACNUC7421 zone)

EMBL: CP001720.PE31

CP001720.PE31        Location/Qualifiers
FT   CDS             34794..36182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0032"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: sfu:Sfum_0727 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60996"
FT                   /db_xref="GOA:C8VVC0"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC0"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ACV60996.1"
FT                   /translation="MKILRVIIMALSFLMTLPVLAWAEEAAAPAVDTGDTSFILISAAI
FT                   VLLMTPGLALFYGGLSRKKNVLNTIMCSFIALGIISIQWAFYGYSLSFGPDVGHFIGSL
FT                   DWLGLKGVGLEPNPDYAATIPHQAFMVFQMVFAIITPAIISGSVAERMRFPAYLAFILL
FT                   WATFIYDPVAHWVWGVGGWLRNLGALDFAGGTVVHIISGVSALVAAMYVGKRKGYGREL
FT                   MIPHNLPMTVLGASLLWFGWFGFNAGSSLGAGSLTTMVFVNTQLATAAAMLSWVIFEWI
FT                   RHGKPTLLGAVSGAVAGLVAITPACGFVTSMSAIIIGFIGGFICFFSVAIMKAKLGYDD
FT                   SFDAFGVHGMGGTWGAIATGLFASKAANELGNDGVFYGNPDQLVTQLIATAASWAVAVV
FT                   GTLVLLKVISLFTKLRASDEEQETGLDFTQHGEDAYTEFVSGSPFGVDMTAGGAPVGAE
FT                   KPAF"
     MKILRVIIMA LSFLMTLPVL AWAEEAAAPA VDTGDTSFIL ISAAIVLLMT PGLALFYGGL        60
     SRKKNVLNTI MCSFIALGII SIQWAFYGYS LSFGPDVGHF IGSLDWLGLK GVGLEPNPDY       120
     AATIPHQAFM VFQMVFAIIT PAIISGSVAE RMRFPAYLAF ILLWATFIYD PVAHWVWGVG       180
     GWLRNLGALD FAGGTVVHII SGVSALVAAM YVGKRKGYGR ELMIPHNLPM TVLGASLLWF       240
     GWFGFNAGSS LGAGSLTTMV FVNTQLATAA AMLSWVIFEW IRHGKPTLLG AVSGAVAGLV       300
     AITPACGFVT SMSAIIIGFI GGFICFFSVA IMKAKLGYDD SFDAFGVHGM GGTWGAIATG       360
     LFASKAANEL GNDGVFYGNP DQLVTQLIAT AASWAVAVVG TLVLLKVISL FTKLRASDEE       420
     QETGLDFTQH GEDAYTEFVS GSPFGVDMTA GGAPVGAEKP AF                          462
//

If you have problems or comments...

PBIL Back to PBIL home page