(data stored in ACNUC7421 zone)

EMBL: CP001720.PE311

CP001720.PE311       Location/Qualifiers
FT   CDS             332977..333798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0323"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   sat:SYN_02198 lysine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61276"
FT                   /db_xref="GOA:C8W422"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C8W422"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACV61276.1"
FT                   /translation="MDNATIFTTALLVGFSGAIMPGPLLTVTIMQTVVKGFKAGLLIVL
FT                   GHAILEALLVAALVLGLASFLVQSEVKSLIAVVGGVFLIYLGFSMARSSRVSFNAVNPS
FT                   LKIENIWQQNVAGEYDKQCKLRNEHYEESLPSNNGGPEKERLSHHDSRYNSETSFSGNI
FT                   KAGGLHGVSMHPVLAGILVSLSNPYWSIWWATLGLSYITLALENGTAGLLSFFSGHILA
FT                   DFIWYALVAAAVAGSRNFIKPAIYRVIVLICAVFLVVLGGYFIHSGIWVHV"
     MDNATIFTTA LLVGFSGAIM PGPLLTVTIM QTVVKGFKAG LLIVLGHAIL EALLVAALVL        60
     GLASFLVQSE VKSLIAVVGG VFLIYLGFSM ARSSRVSFNA VNPSLKIENI WQQNVAGEYD       120
     KQCKLRNEHY EESLPSNNGG PEKERLSHHD SRYNSETSFS GNIKAGGLHG VSMHPVLAGI       180
     LVSLSNPYWS IWWATLGLSY ITLALENGTA GLLSFFSGHI LADFIWYALV AAAVAGSRNF       240
     IKPAIYRVIV LICAVFLVVL GGYFIHSGIW VHV                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page