(data stored in ACNUC7421 zone)

EMBL: CP001720.PE312

CP001720.PE312       Location/Qualifiers
FT   CDS             333967..335370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0324"
FT                   /product="AMMECR1 domain protein"
FT                   /note="PFAM: AMMECR1 domain protein; Extradiol ring-
FT                   cleavage dioxygenase class III protein subunit B; KEGG:
FT                   glo:Glov_0529 AMMECR1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61277"
FT                   /db_xref="GOA:C8W423"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:C8W423"
FT                   /inference="protein motif:PFAM:PF01871"
FT                   /protein_id="ACV61277.1"
FT                   /translation="MSLVYSAVCPHPPIVVPEVGGKEAAQVKNTAEAMLEIGRRIKSSG
FT                   AEILIMISPHSPVFEDAIAIHGNKTLHGNLGRFGASQVAFTLTCETGLVEQIIKTANEN
FT                   GILAVELNQQLAGKYKISLELDHGLMVPLYFLRQSGVELPVVAIAVGLLPFEELYAFGI
FT                   AVQRAVQNYSKKAALLASGDMSHCLKKGAPCGYDPKGEEFDRAIVRLTAAADVEGIIGM
FT                   QPELLERAAECGFRPLLMLLGALDGYKIKSEVLSYEGPFGVGYMVASLAPQEISLDRKF
FT                   SHRWLEIREEQVALRRSNESYLVQLARNSLESNILGKSMDMDTGQAPPEFRKKSGVFVC
FT                   IKKEGRLRGCIGTVFPQQKSIADEVVVNAVSAGLHDHRFPRVQPEELSDLVYSVDVLTE
FT                   PEAISSIKQLDPAKYGVIVRSGHKSGLLLPNLEGVDNVEQQVQIAREKAGIRVDQDVSL
FT                   ERFEVIRYS"
     MSLVYSAVCP HPPIVVPEVG GKEAAQVKNT AEAMLEIGRR IKSSGAEILI MISPHSPVFE        60
     DAIAIHGNKT LHGNLGRFGA SQVAFTLTCE TGLVEQIIKT ANENGILAVE LNQQLAGKYK       120
     ISLELDHGLM VPLYFLRQSG VELPVVAIAV GLLPFEELYA FGIAVQRAVQ NYSKKAALLA       180
     SGDMSHCLKK GAPCGYDPKG EEFDRAIVRL TAAADVEGII GMQPELLERA AECGFRPLLM       240
     LLGALDGYKI KSEVLSYEGP FGVGYMVASL APQEISLDRK FSHRWLEIRE EQVALRRSNE       300
     SYLVQLARNS LESNILGKSM DMDTGQAPPE FRKKSGVFVC IKKEGRLRGC IGTVFPQQKS       360
     IADEVVVNAV SAGLHDHRFP RVQPEELSDL VYSVDVLTEP EAISSIKQLD PAKYGVIVRS       420
     GHKSGLLLPN LEGVDNVEQQ VQIAREKAGI RVDQDVSLER FEVIRYS                     467
//

If you have problems or comments...

PBIL Back to PBIL home page