(data stored in ACNUC7421 zone)

EMBL: CP001720.PE313

CP001720.PE313       Location/Qualifiers
FT   CDS             335515..336516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0325"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   gme:Gmet_1006 radical SAM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61278"
FT                   /db_xref="GOA:C8W424"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:C8W424"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACV61278.1"
FT                   /translation="MREAMYYEKKENNLAACRLCPKLCTIRENRTGFCRARKNIGGTLY
FT                   SLNYGECSSHAIDPIEKKPLYHFYPGTNILSLGTFGCNLRCGFCQNWSIAHETPHTVGI
FT                   TPEQVLDIFRQQAADVNCIGLAYTYSEPLMWYEFVLDTAKLIHAAGFKNVLVTNGYIGE
FT                   EPLREIIPYIDAMNIDIKGFTEEYYHKTCIGNLSPVLRTVEIAVSQNCHVELTTLLITG
FT                   LNDSEEEISNLVNWIAGVNKNIPLHFSRYFPNYQMNLPATPLETLKIACSMAKEKLNYV
FT                   YAGNAAELNVSNTVCPQCGEVIISRLGYRTRIEGLKDSRCMHCGEKIYIVQD"
     MREAMYYEKK ENNLAACRLC PKLCTIRENR TGFCRARKNI GGTLYSLNYG ECSSHAIDPI        60
     EKKPLYHFYP GTNILSLGTF GCNLRCGFCQ NWSIAHETPH TVGITPEQVL DIFRQQAADV       120
     NCIGLAYTYS EPLMWYEFVL DTAKLIHAAG FKNVLVTNGY IGEEPLREII PYIDAMNIDI       180
     KGFTEEYYHK TCIGNLSPVL RTVEIAVSQN CHVELTTLLI TGLNDSEEEI SNLVNWIAGV       240
     NKNIPLHFSR YFPNYQMNLP ATPLETLKIA CSMAKEKLNY VYAGNAAELN VSNTVCPQCG       300
     EVIISRLGYR TRIEGLKDSR CMHCGEKIYI VQD                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page