(data stored in ACNUC7421 zone)

EMBL: CP001720.PE314

CP001720.PE314       Location/Qualifiers
FT   CDS             336604..337260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0326"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: dal:Dalk_3454
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61279"
FT                   /db_xref="GOA:C8W425"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C8W425"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACV61279.1"
FT                   /translation="MIPLKDDIPSSRFPLVNISLIIVNLVIFVYLVLNNNLDVYIMTHG
FT                   VVPKDFFSDFSPFTQFYLFTIAIFLHGGWLHVLGNMLYLWIFGDNVEDRMGHFRYLIFY
FT                   MICGYTATLAHVLADPLSTMPMVGASGAIAGVLGAYLVLFPRARVLTLLPIFFFITFIR
FT                   IPAVLFLAFWFILQIFNGMVSGSAGVAWWAHIGGFIVGMLLVKFMEKKKNKYFFS"
     MIPLKDDIPS SRFPLVNISL IIVNLVIFVY LVLNNNLDVY IMTHGVVPKD FFSDFSPFTQ        60
     FYLFTIAIFL HGGWLHVLGN MLYLWIFGDN VEDRMGHFRY LIFYMICGYT ATLAHVLADP       120
     LSTMPMVGAS GAIAGVLGAY LVLFPRARVL TLLPIFFFIT FIRIPAVLFL AFWFILQIFN       180
     GMVSGSAGVA WWAHIGGFIV GMLLVKFMEK KKNKYFFS                               218
//

If you have problems or comments...

PBIL Back to PBIL home page