(data stored in ACNUC7421 zone)

EMBL: CP001720.PE318

CP001720.PE318       Location/Qualifiers
FT   CDS             341182..342072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0330"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dal:Dalk_0870
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61283"
FT                   /db_xref="GOA:C8W429"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W429"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61283.1"
FT                   /translation="MLVKTFKHKWKSSGFPLKSLPGFLSKLSWSGTAGIAVILAVLLIA
FT                   VLAPWIAVYPHNLSSGAPLLPPGKEHFLGTDELGVDLWAQICFGARVSLLVGLGTALLA
FT                   ALGGGLIGIAAGYSGGWIDKLLMRLIDIMIVLPDLPVMIVLAAFIGPSLTNIILVLALF
FT                   SWVFPARIVRSQVLMLKEQNYIKSAETYGAGTWYLIRRHFLPELFPLLAVNMIRLTGRA
FT                   IVAEAGLSFLGLGDPTSKSWGLILHHATSFRGIYYTDFWKWWLLYPWLALMLMVTSLAF
FT                   ISRELERIVDPRMGR"
     MLVKTFKHKW KSSGFPLKSL PGFLSKLSWS GTAGIAVILA VLLIAVLAPW IAVYPHNLSS        60
     GAPLLPPGKE HFLGTDELGV DLWAQICFGA RVSLLVGLGT ALLAALGGGL IGIAAGYSGG       120
     WIDKLLMRLI DIMIVLPDLP VMIVLAAFIG PSLTNIILVL ALFSWVFPAR IVRSQVLMLK       180
     EQNYIKSAET YGAGTWYLIR RHFLPELFPL LAVNMIRLTG RAIVAEAGLS FLGLGDPTSK       240
     SWGLILHHAT SFRGIYYTDF WKWWLLYPWL ALMLMVTSLA FISRELERIV DPRMGR           296
//

If you have problems or comments...

PBIL Back to PBIL home page