(data stored in ACNUC7421 zone)

EMBL: CP001720.PE320

CP001720.PE320       Location/Qualifiers
FT   CDS             344548..344988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0332"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: bha:BH1396 FUR
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61285"
FT                   /db_xref="GOA:C8W431"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W431"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACV61285.1"
FT                   /translation="MKEAFELLRKNGYKITPQRQEILNTIIDTDNKTPLRAEDIYRKVI
FT                   KRYPNVSVDTIYRNLIILLDLGIIKEINFRDSKSQYYELNLADHHHYLICLGCGVTQSI
FT                   DCPLKSVDEEKIAEEKNFEIKKHNLELYGYCVLCREKTEDKS"
     MKEAFELLRK NGYKITPQRQ EILNTIIDTD NKTPLRAEDI YRKVIKRYPN VSVDTIYRNL        60
     IILLDLGIIK EINFRDSKSQ YYELNLADHH HYLICLGCGV TQSIDCPLKS VDEEKIAEEK       120
     NFEIKKHNLE LYGYCVLCRE KTEDKS                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page