(data stored in ACNUC7421 zone)

EMBL: CP001720.PE322

CP001720.PE322       Location/Qualifiers
FT   CDS             346133..346951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0334"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pag:PLES_58961 zinc transport protein ZnuC"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61287"
FT                   /db_xref="GOA:C8W433"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W433"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61287.1"
FT                   /translation="MTSTGIIEQLNRKSCGLCCTKLKNFGVTVGGKKIIHDIDIHIHCG
FT                   ELTALIGPNGAGKTTLLKAILGEIRYTGELLFLDADNCRRNPVVGYVPQKIDFDASAPI
FT                   SVLDLFAASMSAWPVFLGYSRRFREDVAASLTGVNAEHLLDRRLGELSGGELQRVLLAM
FT                   ALNPNPDLLLLDEPISGIDVRGRELFYELVSNLRQNYDLSIILVSHDWSLMSQYADRIV
FT                   FLDRTVQFCGKPDEVFANENLLRYCGPVLINSINQNRLKPKIFSRYGDLV"
     MTSTGIIEQL NRKSCGLCCT KLKNFGVTVG GKKIIHDIDI HIHCGELTAL IGPNGAGKTT        60
     LLKAILGEIR YTGELLFLDA DNCRRNPVVG YVPQKIDFDA SAPISVLDLF AASMSAWPVF       120
     LGYSRRFRED VAASLTGVNA EHLLDRRLGE LSGGELQRVL LAMALNPNPD LLLLDEPISG       180
     IDVRGRELFY ELVSNLRQNY DLSIILVSHD WSLMSQYADR IVFLDRTVQF CGKPDEVFAN       240
     ENLLRYCGPV LINSINQNRL KPKIFSRYGD LV                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page