(data stored in ACNUC7421 zone)

EMBL: CP001720.PE324

CP001720.PE324       Location/Qualifiers
FT   CDS             347887..348927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0336"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: bsu:BSU03250 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61289"
FT                   /db_xref="GOA:C8W435"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:C8W435"
FT                   /inference="protein motif:PFAM:PF03773"
FT                   /protein_id="ACV61289.1"
FT                   /translation="MYQTATIKRSLKCFFFVFVFVYLIILLGPQTRLIFNAIQKETFSN
FT                   LHLIFFSIIVEALPFVILGVIGSMLLETFVSPDLVRRLLPRTWLLGILVSGLLGILFPF
FT                   CECGLVPIVRRLMEKGVPAPLATVFLLTVPVINPVVGAATHFAFFNRPDFMYWRLGGAY
FT                   IIAITVGFIILRTWRGKNPLKQSNYYHSCGCGCEYGYSYKINRPLGNRLVGAFEHAQQE
FT                   FFSIMQYLIIGAFLASSAQVFLPRLWLTAAGSHPVGSVGVMMGLAFFLSICSGADAFVA
FT                   NTFVNIFTPGSLVAFMVFGPMVDLKNLMMMLSAFKVRFVVRLVFSVTILALTLGVMINK
FT                   MGVIAR"
     MYQTATIKRS LKCFFFVFVF VYLIILLGPQ TRLIFNAIQK ETFSNLHLIF FSIIVEALPF        60
     VILGVIGSML LETFVSPDLV RRLLPRTWLL GILVSGLLGI LFPFCECGLV PIVRRLMEKG       120
     VPAPLATVFL LTVPVINPVV GAATHFAFFN RPDFMYWRLG GAYIIAITVG FIILRTWRGK       180
     NPLKQSNYYH SCGCGCEYGY SYKINRPLGN RLVGAFEHAQ QEFFSIMQYL IIGAFLASSA       240
     QVFLPRLWLT AAGSHPVGSV GVMMGLAFFL SICSGADAFV ANTFVNIFTP GSLVAFMVFG       300
     PMVDLKNLMM MLSAFKVRFV VRLVFSVTIL ALTLGVMINK MGVIAR                      346
//

If you have problems or comments...

PBIL Back to PBIL home page